RegulonDB RegulonDB 10.9: Amino acid Sequence
TraB family protein YbaP Amino Acid Sequence


Size: 264

Fasta

 

>TraB family protein YbaP E. coli K12. Version NC_000913.3 GI:556503834
MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSHDMAPLPTRLLKKLKN
ADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQEMGISPSLFSTQPLWQI
AMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAENQIAMLLQLPDKGLALLD
DTLTHWHTNARLLQQMMSWWLNAPPQNNDITLPNTFSQSLYDVLMHQRNLAWRDKLRAMP
PGRYVVAVGALHLYGEGNLPQMLR
              
                            

Download fasta file
RegulonDB