RegulonDB RegulonDB 11.0: Amino acid Sequence
DNA-binding transcriptional regulator YbaQ Amino Acid Sequence


Size: 113

Fasta

 

>putative DNA-binding transcriptional regulator YbaQ E. coli K12. Version NC_000913.3 GI:556503834
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLA
KVFDTTVDFWLNLQAAVDLWEVENNMRTQEELGRIETVAEYLARREERAKKVA
              
                            

Download fasta file
RegulonDB