RegulonDB RegulonDB 10.9: Amino acid Sequence
soluble Cu+ chaperone Amino Acid Sequence


Size: 70

Fasta

 

>soluble Cu+ chaperone E. coli K12. Version NC_000913.3 GI:556503834
MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTGTASAEQLIETIKQAG
YDASVSHPKG
              
                            

Download fasta file
RegulonDB