RegulonDB RegulonDB 10.9: Amino acid Sequence
putative iron ABC exporter ATP-binding subunit FetA Amino Acid Sequence


Size: 225

Fasta

 

>putative iron ABC exporter ATP-binding subunit FetA E. coli K12. Version NC_000913.3 GI:556503834
MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPT
SGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPDPAIFLDF
LERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMI
HRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA
              
                            

Download fasta file
RegulonDB