RegulonDB RegulonDB 10.9: Amino acid Sequence
NADP+-dependent aldehyde reductase YbbO Amino Acid Sequence


Size: 269

Fasta

 

>NADP+-dependent aldehyde reductase E. coli K12. Version NC_000913.3 GI:556503834
MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAGCRKPDDVERMNSMGF
TGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLSTISRAQMEQQFSANFF
GAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRMELRHS
GIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGPEAVVDKVRHAFISEKPKM
RYPVTLVTWAVMVLKRLLPGRVMDKILQG
              
                            

Download fasta file
RegulonDB