RegulonDB RegulonDB 10.8: Amino acid Sequence
ureidoglycolate lyase Amino Acid Sequence


Size: 160

Fasta

 

>ureidoglycolate lyase E. coli K12. Version NC_000913.3 GI:556503834
MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQ
PANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHR
NVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA
              
                            

Download fasta file
RegulonDB