RegulonDB RegulonDB 10.9: Amino acid Sequence
(S)-ureidoglycine aminohydrolase Amino Acid Sequence


Size: 261

Fasta

 

>(S)-ureidoglycine aminohydrolase E. coli K12. Version NC_000913.3 GI:556503834
MGYLNNVTGYREDLLANRAIVKHGNFALLTPDGLVKNIIPGFENCDATILSTPKLGASFV
DYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALSEGGYLYCPPGSLMTFV
NAQAEDSQIFLYKRRYVPVEGYAPWLVSGNASELERIHYEGMDDVILLDFLPKELGFDMN
MHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPVKKGDYIFMGAYSLQAGYG
VGRGEAFSYIYSKDCNRDVEI
              
                            

Download fasta file
RegulonDB