RegulonDB RegulonDB 11.0: Amino acid Sequence
putative fimbrial adhesin protein SfmH Amino Acid Sequence


Size: 327

Fasta

 

>putative fimbrial adhesin protein SfmH E. coli K12. Version NC_000913.3 GI:556503834
MAMACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQIVVLPEKSGWVGVSAI
CPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVDSVMDIQFPPQNYIRMG
TDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVYVTSTPYDPLVTPVYTIS
FGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVMPQTKSIAVKCTNVAAQ
AYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNSVIPFRLDAAAAANVTLR
AWPISITGQKPTEGPFSALGYLRVDYQ
              
                            

Download fasta file
RegulonDB