RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; putative DNA-binding transcriptional regulator Amino Acid Sequence


Size: 265

Fasta

 

>DLP12 prophage; putative DNA-binding transcriptional regulator E. coli K12. Version NC_000913.3 GI:556503834
MLARGKTNLKIEEIRMHKHHEIHRVKPLMPALCRIRQGKKVINWETHTLTVDNNQIILFP
CGYEFYIENYPEAGLYLAEMLYLPIDLIESFQKLYTVTDQIRNKTSFFLPQNPELIYCWE
QLKTSVSRGFSTKIQEHLAMGVLLSLGVNHVNHLLLSYSKQSLISRCYNLLLSEPGTKWT
ANKVARYLYISVSTLHRRLASEGVSFQSILDDVRLNNALSAIQTTVKPISEIARENGYKC
PSRFTERFHNRFNITPREIRKASRE
              
                            

Download fasta file
RegulonDB