RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; prophage antitermination protein Q homolog QuuD Amino Acid Sequence


Size: 127

Fasta

 

>DLP12 prophage; putative antitermination protein E. coli K12. Version NC_000913.3 GI:556503834
MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLITSKVKSRPQCCDDDAMIICGCMARL
KKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEGIIEGMLMALDIRLEMD
IVVNNSN
              
                            

Download fasta file
RegulonDB