RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; DUF1398 domain-containing protein YbcV Amino Acid Sequence


Size: 136

Fasta

 

>DLP12 prophage; DUF1398 domain-containing protein YbcV E. coli K12. Version NC_000913.3 GI:556503834
MAQVAIFKEIFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLK
KVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWITNIHEHKRYYYTFDNS
LLFTESIQNTTQIFPR
              
                            

Download fasta file
RegulonDB