RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; uncharacterized protein YbcW Amino Acid Sequence


Size: 68

Fasta

 

>DLP12 prophage; uncharacterized protein YbcW E. coli K12. Version NC_000913.3 GI:556503834
MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEAFRAIEAALVKHDNNM
KDYSLVVD
              
                            

Download fasta file
RegulonDB