RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; putative tail fiber assembly protein TfaD Amino Acid Sequence


Size: 187

Fasta

 

>DLP12 prophage; putative tail fiber assembly protein TfaD E. coli K12. Version NC_000913.3 GI:556503834
MNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIPAGFVAVFNSDESSWHL
VEDHRGKTVYDVASGDALFISELGPLPENVTWLSPEGEFQKWNGTAWVKDAEAEKLFRIR
EAEETKNSLMQVASEHIAPLQDAVDLEIATEEETSLLEAWKKYRVLLNRVDTSTAPDIEW
PTNPVRE
              
                            

Download fasta file
RegulonDB