RegulonDB RegulonDB 10.9: Amino acid Sequence
PF04237 family protein YbdF Amino Acid Sequence


Size: 122

Fasta

 

>PF04237 family protein YbdF E. coli K12. Version NC_000913.3 GI:556503834
MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSELRGVPFINLKSDPQK
SLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSWNLVVDGLAKRDQKRVR
PG
              
                            

Download fasta file
RegulonDB