RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1158 domain-containing protein YbdJ Amino Acid Sequence


Size: 82

Fasta

 

>DUF1158 domain-containing protein YbdJ E. coli K12. Version NC_000913.3 GI:556503834
MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL
VLGAIEYFVLRFIWRRWFSLAD
              
                            

Download fasta file
RegulonDB