RegulonDB RegulonDB 10.9: Amino acid Sequence
carboxylate-amine ligase Amino Acid Sequence


Size: 372

Fasta

 

>carboxylate-amine ligase E. coli K12. Version NC_000913.3 GI:556503834
MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNKITAGEVKHDITESMLE
LATDVCRDINQAAGQFSAMQKVVLQAATDHHLEICGGGTHPFQKWQRQEVCDNERYQRTL
ENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIALSAASPYMQGTDTRFAS
SRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKDLHWDIRPSPHFGTVEVRV
MDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYKFNRFQACRYGLEGVITDPH
TGDRRPLTEDTLRLLEKIAPSAHKIGASSAIEALHRQVVSGLNEAQLMRDFVADGGSLIG
LVKKHCEIWAGD
              
                            

Download fasta file
RegulonDB