RegulonDB RegulonDB 10.9: Amino acid Sequence
putative Zn2+-dependent alcohol dehydrogenase YbdR Amino Acid Sequence


Size: 412

Fasta

 

>putative Zn2+-dependent alcohol dehydrogenase YbdR E. coli K12. Version NC_000913.3 GI:556503834
MKALTYHGPHHVQVENVPDPGVEQADDIILRITATAICGSDLHLYRGKIPQVKHGDIFGH
EFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRLQQYAACENTNAGKGAALNKKQI
PAPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDDKALFLSDILPTAWQAAK
NAQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPYRLHFAADRYGAIPINFDE
DSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNLKLEGSSGKALRQCIAAVRR
GGIVSVPGVYAGFIHGFLFGDAFDKGLSFKMGQTHVHAWLGELLPLIEKGLLKPEEIVTH
YMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKAVSGLVNAMPGGTI
              
                            

Download fasta file
RegulonDB