RegulonDB RegulonDB 10.10: Amino acid Sequence
nucleoside diphosphate kinase regulator Amino Acid Sequence


Size: 136

Fasta

 

>nucleoside diphosphate kinase regulator E. coli K12. Version NC_000913.3 GI:556503834
MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCSPEEMPHDVVTMNSRV
KFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSIHWELPGGVATHLE
VLELEYQPEAAGDYLL
              
                            

Download fasta file
RegulonDB