RegulonDB RegulonDB 10.9: Amino acid Sequence
putative adenosylcobalamin phosphatase/α-ribazole phosphatase Amino Acid Sequence


Size: 203

Fasta

 

>putative adenosylcobalamin phosphatase/α-ribazole phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQH
TARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA
              
                            

Download fasta file
RegulonDB