RegulonDB RegulonDB 10.9: Amino acid Sequence
J domain-containing protein DjlB Amino Acid Sequence


Size: 475

Fasta

 

>putative chaperone E. coli K12. Version NC_000913.3 GI:556503834
MKNCWKILDIEETTDVDIIRRAYLALLPSFHPETDPQGFKQLRQAYEEALRIAQSPAKSV
WQPEEYEVAEHEILLAFRALLASDSERFLPSAWQRFIQQLNYCSMEEIDELRWSLCTIAM
NTAHLSFECVVLLAERLRWLQEENTGEIDEEELESFLYAIAKGNVFNFQTILHLPVAVQN
DTIDFYQMFARIWSSHPQWLTLYLAQHRAVIIPDDAKLHRNLLRWYSAGRLDIPELLDYA
QSWRETEPDNEDAPYYEYAQRVYCGEGESLLAELCDYWREYPSTQADALMLQWCRQHRVD
YYPLLVMMIEARDLVNDQGKPLLYVPGDSARTRFHLYEILSDEKLSALGRSLVEMVLHKG
RKPRISLTRDTEHTLWPLYLVAKQLVQACQPTEESLMPIVSRLDAENRCPLEALIIRRLL
IQAANFTEKQTVEPEPQPQPMPVDDGGPGCLGIIKIIFYIFIFAGLIGKILHLFG
              
                            

Download fasta file
RegulonDB