RegulonDB RegulonDB 10.9: Amino acid Sequence
Sel1 repeat-containing protein YbeT Amino Acid Sequence


Size: 184

Fasta

 

>Sel1 repeat-containing protein YbeT E. coli K12. Version NC_000913.3 GI:556503834
MNKKLMYIFAIFIVAAITCISQPKKTTLRDKAMVNYAFDYLSSPGSLPFTTAATELSAIH
GHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQSKLGWIYLKGLGVKPDT
RKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWLKLTAKQHYKNAERLLAG
LPAH
              
                            

Download fasta file
RegulonDB