RegulonDB RegulonDB 10.9: Amino acid Sequence
co-chaperone DjlC Amino Acid Sequence


Size: 483

Fasta

 

>co-chaperone DjlC E. coli K12. Version NC_000913.3 GI:556503834
MKTCWQILEIESTTQIDIIRQAYLARLPLCHPETDPQGFKALRQAYEEALRLAVNPVEEA
DDEEKDAAAEHEILRAFRTLLDSESDRFQPSAWQKFIQQLNTWNMEDVDQLRWPLCAIAI
EARYLSLNCASLLAERLNWHSFNDSEGMDEEEREAFLEAIQAGDCFDFLSLLEYPIALQN
QTVEYYFALERCCRYHPDYVTAFLAMEGPWLIPDDAKLHRKLLRWYSSVQTGMAELIPVA
QQWQTEEPESEDARYYLCAQRLYCGEGESLLADLCAYWESYPSTQADNLLLQWSKRHCPD
YFALLVMVIEARSMVDAQGQPLKYVPGESARTRLLWAEILHSGKLSPLGQSFIESLFFKR
KAWAWWKSRVGSETEQDSPFLDLYRVAEQVVLEAFPKQEMLARLNTRLEGGDAHPLEAIV
TRMLLTKVKLEPEDEDVDEPTPENHEEKNDEGEKPQSITSIIKISLTVLVIGYALGKIAM
LFS
              
                            

Download fasta file
RegulonDB