RegulonDB RegulonDB 10.9: Amino acid Sequence
pyrimidine-specific ribonucleoside hydrolase RihA Amino Acid Sequence


Size: 311

Fasta

 

>pyrimidine-specific ribonucleoside hydrolase RihA E. coli K12. Version NC_000913.3 GI:556503834
MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLRMLTLLNRTD
IPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTAVELMAKTLRESAEPVT
IVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAAEFNIYVDPEAAEIVFQS
GIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDFFLEYHKDEKWGFVGAPLH
DPCTIAWLLKPELFTSVERWVGVETQGKYTQGMTVVDYYYLTGNKPNATVMVDVDRQGFV
DLLADRLKFYA
              
                            

Download fasta file
RegulonDB