RegulonDB RegulonDB 10.8: Amino acid Sequence
radiation resistance protein YbgI Amino Acid Sequence


Size: 247

Fasta

 

>radiation resistance protein YbgI E. coli K12. Version NC_000913.3 GI:556503834
MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTASQALLDEAVRLGADAV
IVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHPELGNNAQLAALLGITV
MGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPEVVQRVAWCTGGGQSFID
SAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGGIRALSEWLNENTDLDVTF
IDIPNPA
              
                            

Download fasta file
RegulonDB