RegulonDB RegulonDB 10.9: Amino acid Sequence
Bax1-I family protein YbhM Amino Acid Sequence


Size: 237

Fasta

 

>Bax1-I family protein YbhM E. coli K12. Version NC_000913.3 GI:556503834
MESYSQNSNKLDFQHEARILNGIWLITALGLVATAGLAWGAKYIEITATKYDSPPMYVAI
GLLLLCMYGLSKDINKINAAIAGVIYLFLLSLVAIVVASLVPVYAIIIVFSTAGAMFLIS
MLAGLLFNVDPGSHRFIIMMTLTGLALVIIVNAALMSERPIWIISCLMIVLWSGIISHGR
NKLLELAGKCHSEELWSPVRCAFTGALTLYYYFIGFFGILAAIAITLVWQRHTRFFH
              
                            

Download fasta file
RegulonDB