RegulonDB RegulonDB 10.9: Amino acid Sequence
PKHD-type hydroxylase YbiX Amino Acid Sequence


Size: 225

Fasta

 

>PKHD-type hydroxylase YbiX E. coli K12. Version NC_000913.3 GI:556503834
MMYHIPGVLSPQDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQNEV
LNAVNQHALFFAAALPRTLSTPLFNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFL
SDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFMWIQSMIR
DDKKRAMLFELDNNIQSLKSRYGESEEILSLLNLYHNLLREWSEI
              
                            

Download fasta file
RegulonDB