RegulonDB RegulonDB 10.9: Amino acid Sequence
moderate conductance mechanosensitive channel YbiO Amino Acid Sequence


Size: 741

Fasta

 

>moderate conductance mechanosensitive channel YbiO E. coli K12. Version NC_000913.3 GI:556503834
MRWILFILFCLLGAPAHAVSIPGVTTTTTTDSTTEPAPEPDIEQKKAAYGALADVLDNDT
SRKELIDQLRTVAATPPAEPVPKIVPPTLVEEQTVLQKVTEVSRHYGEALSARFGQLYRN
ITGSPHKPFNPQTFSNALTHFSMLAVLVFGFYWLIRLCALPLYRKMGQWARQKNRERSNW
LQLPAMIIGAFIIDLLLLALTLFVGQVLSDNLNAGSRTIAFQQSLFLNAFALIEFFKAVL
RLIFCPNVAELRPFTIQDESARYWSRRLSWLSSLIGYGLIVAVPIISNQVNVQIGALANV
IIMLCMTVWALYLIFRNKKEITQHLLNFAEHSLAFFSLFIRAFALVWHWLASAYFIVLFF
FSLFDPGNSLKFMMGATVRSLAIIGIAAFVSGMFSRWLAKTITLSPHTQRNYPELQKRLN
GWLSAALKTARILTVCVAVMLLLSAWGLFDFWNWLQNGAGQKTVDILIRIALILFFSAVG
WTVLASLIENRLASDIHGRPLPSARTRTLLTLFRNALAVIISTITIMIVLSEIGVNIAPL
LAGAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVR
QDTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKANQALKDAVAELMENEEIR
GLIIGEPNFAGIVGLSNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLAGVRAPVQTY
QVLPAPGATPAEPLPPGEPTL
              
                            

Download fasta file
RegulonDB