RegulonDB RegulonDB 10.9: Amino acid Sequence
L,D-transpeptidase LdtB Amino Acid Sequence


Size: 306

Fasta

 

>L,D-transpeptidase LdtB E. coli K12. Version NC_000913.3 GI:556503834
MNMKLKTLFAAAFAVVGFCSTASAVTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEY
QMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTV
IVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPM
GLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKA
TTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSG
MPVRLN
              
                            

Download fasta file
RegulonDB