RegulonDB RegulonDB 10.8: Amino acid Sequence
fructose-6-phosphate aldolase 1 Amino Acid Sequence


Size: 220

Fasta

 

>fructose-6-phosphate aldolase 1 E. coli K12. Version NC_000913.3 GI:556503834
MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQV
MATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLS
ALAGAEYVAPYVNRIDAQGGSGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAG
CESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI
              
                            

Download fasta file
RegulonDB