RegulonDB RegulonDB 10.8: Amino acid Sequence
glutathione ABC transporter membrane subunit GsiC Amino Acid Sequence


Size: 306

Fasta

 

>glutathione ABC transporter membrane subunit GsiC E. coli K12. Version NC_000913.3 GI:556503834
MLNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQP
LYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIA
AVWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVELGWLPTVGADSWQHYILPSLTL
GAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG
FLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVVDVLYAAIN
PAIRYK
              
                            

Download fasta file
RegulonDB