RegulonDB RegulonDB 11.0: Amino acid Sequence
putative c-di-GMP phosphodiesterase PdeI Amino Acid Sequence


Size: 782

Fasta

 

>putative c-di-GMP phosphodiesterase PdeI E. coli K12. Version NC_000913.3 GI:556503834
MLSLYEKIKIRLIILFLLAALSFIGLFFIINYQLVSERAVKRADSRFELIQKNVGYFFKD
IERSALTLKDSLYLLKNTEEIQRAVILKMEMMPFLDSVGLVLDDNKYYLFSRRANDKIVV
YHQEQVNGPLVDESGRVIFADFNPSKRPWSVASDDSNNSWNPAYNCFDRPGKKCISFTLH
INGKDHDLLAVDKIHVDLNWRYLNEYLDQISANDEVLFLKQGHEIIAKNQLAREKLIIYN
SEGNYNIIDSVDTEYIEKTSAVPNNALFEIYFYYPGGNLLNASDKLFYLPFAFIIIVLLV
VYLMTTRVFRRQFSEMTELVNTLAFLPDSTDQIEALKIREGDAKEIISIKNSIAEMKDAE
IERSNKLLSLISYDQESGFIKNMAIIESNNNQYLAVGIIKLCGLEAVEAVFGVDERNKIV
RKLCQRIAEKYAQCCDIVTFNADLYLLLCRENVQTFTRKIAMVNDFDSSFGYRNLRIHKS
AICEPLQGENAWSYAEKLKLAISSIRDHMFSEFIFCDDAKLNEIEENIWIARNIRHAMEI
GELFLVYQPIVDINTRAILGAEALCRWVSAERGIISPLKFITIAEDIGFINELGYQIIKT
AMGEFRHFSQRASLKDDFLLHINVSPWQLNEPHFHERFTTIMKENGLKANSLCVEITETV
IERINEHFYLNIEQLRKQGVRISIDDFGTGLSNLKRFYEINPDSIKVDSQFTGDIFGTAG
KIVRIIFDLARYNRIPVIAEGVESEDVARELIKLGCVQAQGYLYQKPMPFSAWDKSGKLV
KE
              
                            

Download fasta file
RegulonDB