RegulonDB RegulonDB 11.0: Amino acid Sequence
putative diguanylate cyclase DgcI Amino Acid Sequence


Size: 442

Fasta

 

>putative diguanylate cyclase DgcI E. coli K12. Version NC_000913.3 GI:556503834
MSRINKFVLTVSLLIFIMISAVACGIYTQMVKERVYSLKQSVIDTAFAVANIAEYRRSVA
IDLINTLNPTEEQLLVGLRTAYADSVSPSYLYDVGPYLISSDECIQVKEFEKNYCADIMQ
VVKYRHVKNTGFISFDGKTFVYYLYPVTHNRSLIFLLGLERFSLLSKSLAMDSENLMFSL
FKNGKPVTGDEYNAKNAIFTVSEAMEHFAYLPTGLYVFAYKKDVYLRVCTLIIFFAALVA
VISGASCLYLVRRVINRGIVEKEAIINNHFERVLDGGLFFSAADVKKLYSMYNSAFLDDL
TKAMGRKSFDEDLKALPEKGGYLCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPV
DKGKVYRFGGDEFAVIYTGGTLEELLSILKEIVHFQVGSINLSTSIGVAHSNECPTVERL
KMLADERLYKSKKNGRAQISWQ
              
                            

Download fasta file
RegulonDB