RegulonDB RegulonDB 10.9: Amino acid Sequence
undecaprenyl pyrophosphate phosphatase Amino Acid Sequence


Size: 198

Fasta

 

>undecaprenyl pyrophosphate phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MLENLNLSLFSLINATPDSAPWMISLAIFIAKDLITVVPLLAVVLWLWGLTAQRQLVIKI
AIALAVSLFVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWH
RLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQIIWQAMGHKLYQRLQ
SWYRVCFALPIRKGWVRD
              
                            

Download fasta file
RegulonDB