RegulonDB RegulonDB 11.0: Amino acid Sequence
uncharacterized protein YbjH Amino Acid Sequence


Size: 94

Fasta

 

>uncharacterized protein YbjH E. coli K12. Version NC_000913.3 GI:556503834
MIMKNCLLLGALLMGFTGVAMAQSVTVDVPSGYKVVVVPDSVSVPQAVSVATVPQTVYVA
PAPAPAYRPHPYVRHLASVGEGMVIEHQIDDHHH
              
                            

Download fasta file
RegulonDB