RegulonDB RegulonDB 10.9: Amino acid Sequence
inner membrane protein YbjJ Amino Acid Sequence


Size: 402

Fasta

 

>inner membrane protein YbjJ E. coli K12. Version NC_000913.3 GI:556503834
MTVNSSRNALKRRTWALFMFFFLPGLLMASWATRTPAIRDILSVSIAEMGGVLFGLSIGS
MSGILCSAWLVKRFGTRNVILVTMSCALIGMMILSLALWLTSPLLFAVGLGVFGASFGSA
EVAINVEGAAVEREMNKTVLPMMHGFYSLGTLAGAGVGMALTAFGVPATVHILLAALVGI
APIYIAIQAIPDGTGKNAADGTQHGEKGVPFYRDIQLLLIGVVVLAMAFAEGSANDWLPL
LMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIF
VDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGY
LGEHYGLRSAMLVVLALVILAAIVAKAVAKPDTKTQTAMENS
              
                            

Download fasta file
RegulonDB