RegulonDB RegulonDB 10.8: Amino acid Sequence
protein YbjN Amino Acid Sequence


Size: 158

Fasta

 

>protein YbjN E. coli K12. Version NC_000913.3 GI:556503834
MTSLVVPGLDTLRQWLDDLGMSFFECDNCQALHLPHMQNFDGVFDAKIDLIDNTILFSAM
AEVRPSAVLPLAADLSAINASSLTVKAFLDMQDDNLPKLVVCQSLSVMQGVTYEQFAWFV
RQSEEQISMVILEANAHQLLLPTDDEGQNNVTENYFLH
              
                            

Download fasta file
RegulonDB