RegulonDB RegulonDB 10.8: Amino acid Sequence
23S rRNA m5U747 methyltransferase Amino Acid Sequence


Size: 375

Fasta

 

>23S rRNA m5U747 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MQCALYDAGRCRSCQWIMQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAK
MVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRG
ELKYILLTESQSDGGMMLRFVLRSDTKLAQLRKALPWLHEQLPQLKVITVNIQPVHMAIM
EGETEIYLTEQQALAERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDL
FCGVGGFGLHCATPDMQLTGIEIASEAIACAKQSAAELGLTRLQFQALDSTQFATAQGDV
PELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGFRIERVQLFDMF
PHTAHYEVLTLLVKQ
              
                            

Download fasta file
RegulonDB