RegulonDB RegulonDB 10.9: Amino acid Sequence
putative epimerase YbjS Amino Acid Sequence


Size: 337

Fasta

 

>putative NAD(P)H-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain E. coli K12. Version NC_000913.3 GI:556503834
MKVLVTGATSGLGRNAVEFLCQKGISVRATGRNEAMGKLLEKMGAEFVPADLTELVSSQA
KVMLAGIDTLWHCSSFTSPWGTQQAFDLANVRATRRLGEWAVAWGVRNFIHISSPSLYFD
YHHHRDIKEDFRPHRFANEFARSKAASEEVINMLSQANPQTRFTILRPQSLFGPHDKVFI
PRLAHMMHHYGSILLPHGGSALVDMTYYENAVHAMWLASQEACDKLPSGRVYNITNGEHR
TLRSIVQKLIDELNIDCRIRSVPYPMLDMIARSMERLGRKSAKEPPLTHYGVSKLNFDFT
LDITRAQEELGYQPVITLDEGIEKTAAWLRDHGKLPR
              
                            

Download fasta file
RegulonDB