RegulonDB RegulonDB 10.9: Amino acid Sequence
low-specificity L-threonine aldolase Amino Acid Sequence


Size: 333

Fasta

 

>low-specificity L-threonine aldolase E. coli K12. Version NC_000913.3 GI:556503834
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
              
                            

Download fasta file
RegulonDB