RegulonDB RegulonDB 10.9: Amino acid Sequence
cell division DNA translocase FtsK Amino Acid Sequence


Size: 1329

Fasta

 

>cell division DNA translocase FtsK E. coli K12. Version NC_000913.3 GI:556503834
MSQEYIEDKEVTLTKLSSGRRLLEALLILIVLFAVWLMAALLSFNPSDPSWSQTAWHEPI
HNLGGMPGAWLADTLFFIFGVMAYTIPVIIVGGCWFAWRHQSSDEYIDYFAVSLRIIGVL
ALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHSSGGTIALLCVWAAGLTLFTG
WSWVTIAEKLGGWILNILTFASNRTRRDDTWVDEDEYEDDEEYEDENHGKQHESRRARIL
RGALARRKRLAEKFINPMGRQTDAALFSGKRMDDDEEITYTARGVAADPDDVLFSGNRAT
QPEYDEYDPLLNGAPITEPVAVAAAATTATQSWAAPVEPVTQTPPVASVDVPPAQPTVAW
QPVPGPQTGEPVIAPAPEGYPQQSQYAQPAVQYNEPLQQPVQPQQPYYAPAAEQPAQQPY
YAPAPEQPVAGNAWQAEEQQSTFAPQSTYQTEQTYQQPAAQEPLYQQPQPVEQQPVVEPE
PVVEETKPARPPLYYFEEVEEKRAREREQLAAWYQPIPEPVKEPEPIKSSLKAPSVAAVP
PVEAAAAVSPLASGVKKATLATGAAATVAAPVFSLANSGGPRPQVKEGIGPQLPRPKRIR
VPTRRELASYGIKLPSQRAAEEKAREAQRNQYDSGDQYNDDEIDAMQQDELARQFAQTQQ
QRYGEQYQHDVPVNAEDADAAAEAELARQFAQTQQQRYSGEQPAGANPFSLDDFEFSPMK
ALLDDGPHEPLFTPIVEPVQQPQQPVAPQQQYQQPQQPVPPQPQYQQPQQPVAPQPQYQQ
PQQPVAPQQQYQQPQQPVAPQQQYQQPQQPVAPQPQDTLLHPLLMRNGDSRPLHKPTTPL
PSLDLLTPPPSEVEPVDTFALEQMARLVEARLADFRIKADVVNYSPGPVITRFELNLAPG
VKAARISNLSRDLARSLSTVAVRVVEVIPGKPYVGLELPNKKRQTVYLREVLDNAKFRDN
PSPLTVVLGKDIAGEPVVADLAKMPHLLVAGTTGSGKSVGVNAMILSMLYKAQPEDVRFI
MIDPKMLELSVYEGIPHLLTEVVTDMKDAANALRWCVNEMERRYKLMSALGVRNLAGYNE
KIAEADRMMRPIPDPYWKPGDSMDAQHPVLKKEPYIVVLVDEFADLMMTVGKKVEELIAR
LAQKARAAGIHLVLATQRPSVDVITGLIKANIPTRIAFTVSSKIDSRTILDQAGAESLLG
MGDMLYSGPNSTLPVRVHGAFVRDQEVHAVVQDWKARGRPQYVDGITSDSESEGGAGGFD
GAEELDPLFDQAVQFVTEKRKASISGVQRQFRIGYNRAARIIEQMEAQGIVSEQGHNGNR
EVLAPPPFD
              
                            

Download fasta file
RegulonDB