RegulonDB RegulonDB 10.9: Amino acid Sequence
periplasmic protease YcaL Amino Acid Sequence


Size: 254

Fasta

 

>periplasmic protease YcaL E. coli K12. Version NC_000913.3 GI:556503834
MKNTKLLLAIATSAALLTGCQNTHGIDTNMAISSGLNAYKAATLSDADAKAIANQGCAEM
DSGNQVASKSSKYGKRLAKIAKALGNNINGTPVNYKVYMTSDVNAWAMANGCVRVYSGLM
DMMNDNEIEGVLGHELGHVALGHSLAEMKASYAIVAARDAISATSGVASQLSRSQLGDIA
EGAINAKYSRDKESEADDFSFDLLKKRGISTQGLVGSFETLASLDGGRTQSMFDSHPPST
ERAQHIRDRIASGK
              
                            

Download fasta file
RegulonDB