RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidoglycan LD-endopeptidase Amino Acid Sequence


Size: 182

Fasta

 

>DUF882 domain-containing protein YcbK E. coli K12. Version NC_000913.3 GI:556503834
MDKFDANRRKLLALGGVALGAAILPTPAFATLSTPRPRILTLNNLHTGESIKAEFFDGRG
YIQEELAKLNHFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNEL
RARSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPAR
HW
              
                            

Download fasta file
RegulonDB