RegulonDB RegulonDB 10.9: Amino acid Sequence
FMNH2-dependent alkanesulfonate monooxygenase Amino Acid Sequence


Size: 381

Fasta

 

>FMNH2-dependent alkanesulfonate monooxygenase E. coli K12. Version NC_000913.3 GI:556503834
MSLNMFWFLPTHGDGHYLGTEEGSRPVDHGYLQQIAQAADRLGYTGVLIPTGRSCEDAWL
VAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDRLSNGRALFNLVTGSDPQELAGDG
VFLDHSERYEASAEFTQVWRRLLQRETVDFNGKHIHVRGAKLLFPAIQQPYPPLYFGGSS
DVAQELAAEQVDLYLTWGEPPELVKEKIEQVRAKAAAHGRKIRFGIRLHVIVRETNDEAW
QAAERLISHLDDETIAKAQAAFARTDSVGQQRMAALHNGKRDNLEISPNLWAGVGLVRGG
AGTALVGDGPTVAARINEYAALGIDSFVLSGYPHLEEAYRVGELLFPLLDVAIPEIPQPQ
PLNPQGEAVANDFIPRKVAQS
              
                            

Download fasta file
RegulonDB