RegulonDB RegulonDB 10.9: Amino acid Sequence
putative laminin-binding fimbrial subunit Amino Acid Sequence


Size: 179

Fasta

 

>putative laminin-binding fimbrial subunit E. coli K12. Version NC_000913.3 GI:556503834
MKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVS
ATKLQTNGQVSGVQIDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNV
ALQMYMNDGTTAITPDTETGNILLQDGDQTLTFKVDYIATGKATSGNVNAVTNFHINYY
              
                            

Download fasta file
RegulonDB