RegulonDB RegulonDB 10.9: Amino acid Sequence
putative fimbrial-like adhesin protein Amino Acid Sequence


Size: 356

Fasta

 

>putative fimbrial-like adhesin protein E. coli K12. Version NC_000913.3 GI:556503834
MQIIFGEKCVSLLRLFFAAVLMLWCAQTAAYSGQCHTTQGNPYIGVNFGVKTLEEEANTA
GVVKDKFYQWNESNDYYVSCDCDKDNVRSGRWAFAADSPLVYLGDNWYKINDYLAAKVLL
QVKGSSPTAVPFENVGTGGDTRWHICDPGGQRLGGQGASGNSGSFSLKILQPFVGSVVIP
PMALARLYECYNIPAGDSCTTTGTPVLVYYLSGTINSLGSCSVNAGETIEVDLGDVFAAN
FRVVGHKPLGARTAELAIPVRCNTGNAGLVNVNLSLTATTDPSYPQAIKTSRPGVGVVVT
DSQNNIISPAGGTLPLSIPDDADSIARMNVYPVSTTGVPPETGRFEATATVRINFD
              
                            

Download fasta file
RegulonDB