RegulonDB RegulonDB 10.9: Amino acid Sequence
intermembrane transport protein PqiA Amino Acid Sequence


Size: 417

Fasta

 

>intermembrane transport protein PqiA E. coli K12. Version NC_000913.3 GI:556503834
MCEHHHAAKHILCSQCDMLVALPRLEHGQKAACPRCGTTLTVAWDAPRQRPTAYALAALF
MLLLSNLFPFVNMNVAGVTSEITLLEIPGVLFSEDYASLGTFFLLFVQLVPAFCLITILL
LVNRAELPVRLKEQLARVLFQLKTWGMAEIFLAGVLVSFVKLMAYGSIGVGSSFLPWCLF
CVLQLRAFQCVDRRWLWDDIAPMPELRQPLKPGVTGIRQGLRSCSCCTAILPADEPVCPR
CSTKGYVRRRNSLQWTLALLVTSIMLYLPANILPIMVTDLLGSKMPSTILAGVILLWSEG
SYPVAAVIFLASIMVPTLKMIAIAWLCWDAKGHGKRDSERMHLIYEVVEFVGRWSMIDVF
VIAVLSALVRMGGLMSIYPAMGALMFALVVIMTMFSAMTFDPRLSWDRQPESEHEES
              
                            

Download fasta file
RegulonDB