RegulonDB RegulonDB 10.9: Amino acid Sequence
putative HspQ acetyl donor Amino Acid Sequence


Size: 137

Fasta

 

>putative CoA-binding protein with NAD(P)-binding Rossmann-fold domain E. coli K12. Version NC_000913.3 GI:556503834
MKETDIAGILTSTHTIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGKTLLGQKG
YGTLADVPEKVDMVDVFRNSEAAWGVAQEAIAIGAKTLWMQLGVINEQAAVLARDAGLNV
VMDRCPAIEIPRLGLAK
              
                            

Download fasta file
RegulonDB