RegulonDB RegulonDB 10.9: Amino acid Sequence
23S rRNA m5C1962 methyltransferase Amino Acid Sequence


Size: 396

Fasta

 

>23S rRNA m5C1962 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSVRLVLAKGREKSLLRRHPWVFSGAVARMEGKASLGETIDIVDHQGKWLARGAYSPASQ
IRARVWTFDPSESIDIAFFSRRLQQAQKWRDWLAQKDGLDSYRLIAGESDGLPGITIDRF
GNFLVLQLLSAGAEYQRAALISALQTLYPECSIYDRSDVAVRKKEGMELTQGPVTGELPP
ALLPIEEHGMKLLVDIQHGHKTGYYLDQRDSRLATRRYVENKRVLNCFSYTGGFAVSALM
GGCSQVVSVDTSQEALDIARQNVELNKLDLSKAEFVRDDVFKLLRTYRDRGEKFDVIVMD
PPKFVENKSQLMGACRGYKDINMLAIQLLNEGGILLTFSCSGLMTSDLFQKIIADAAIDA
GRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM
              
                            

Download fasta file
RegulonDB