RegulonDB RegulonDB 10.8: Amino acid Sequence
capsule biosynthesis GfcC family protein Amino Acid Sequence


Size: 248

Fasta

 

>capsule biosynthesis GfcC family protein E. coli K12. Version NC_000913.3 GI:556503834
MNKLQSYFIASVLYVMTPHAFAQGTVTIYLPGEQQTLSVGPVENVVQLVTQPQLRDRLWW
PGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKL
DPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWQAGRSVTDYLQDHPRL
AGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVS
VLTQRVPD
              
                            

Download fasta file
RegulonDB