RegulonDB RegulonDB 10.8: Amino acid Sequence
CspA family protein CspH Amino Acid Sequence


Size: 70

Fasta

 

>CspA family protein CspH E. coli K12. Version NC_000913.3 GI:556503834
MSRKMTGIVKTFDRKSGKGFIIPSDGRKEVQVHISAFTPRDAEVLIPGLRVEFCRVNGLR
GPTAANVYLS
              
                            

Download fasta file
RegulonDB